SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|22901|fgenesh1_pm.00168_#_168 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|22901|fgenesh1_pm.00168_#_168
Domain Number 1 Region: 171-277
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000962
Family Thioredoxin-like 2Fe-2S ferredoxin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|22901|fgenesh1_pm.00168_#_168
Sequence length 290
Sequence
MFRSLLSRGGLIRNDSYVFPTVDPNEDGPDCRMDCADCTVQFPSKVKVETSRPLYGHIKE
FHTHVLVATGKSDWTEKVENEKGSLMEAFDESSHRSKHGRIMISASNLESPETDENTEGT
TILLLPSFTFIDSVQRSDISDVITRFIDAPLSQNGIPANPESKLSPRPCQYDYVVLLCSH
RRRDARCGITAPLIKKELERHLRPLGLYRDANDERPGGVGIFFVSHVGGHKFSANVLIYR
KEQEQMIWLARIKPEHCEGVVKYTLLQGKVVHPESQLRGGFDRSRGVTSW
Download sequence
Identical sequences A0A1R3RQE5
jgi|Aspca1|22901|fgenesh1_pm.00168_#_168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]