SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|24079|fgenesh1_pm.00609_#_627 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|24079|fgenesh1_pm.00609_#_627
Domain Number 1 Region: 64-200
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.56e-28
Family Glutathione peroxidase-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|24079|fgenesh1_pm.00609_#_627
Sequence length 219
Sequence
MVELRKRKAPAQPLVAERKSKKVQASTAPKELAQKGNDNSKPALSENTPKVGDTIDLDKF
GGDLETNDGQKITLQDLVESSKAGVVLFTYPRASTPGCTKQACLFRDHYDTLSESGLSIY
GLSTDSPKANTTFKTKNELPYPLLCNPSSSLIKALGLKKLPKGTIRGVFALDKQGKVLVL
QAGGPDATVNAVQKLVTELKEQNPDPATVRVNSPAEDEH
Download sequence
Identical sequences A0A1R3RT70
jgi|Aspca1|24079|fgenesh1_pm.00609_#_627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]