SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|24171|fgenesh1_pm.00626_#_66 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|24171|fgenesh1_pm.00626_#_66
Domain Number 1 Region: 188-339
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.23e-35
Family UAS domain 0.0001
Further Details:      
 
Domain Number 2 Region: 395-508
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000878
Family UBX domain 0.023
Further Details:      
 
Domain Number 3 Region: 4-43
Classification Level Classification E-value
Superfamily UBA-like 0.0000000425
Family TAP-C domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|24171|fgenesh1_pm.00626_#_66
Sequence length 513
Sequence
MDGDVVAQFTEITGSKPELAAQYLQLADFNIEQAVQLFFENGGAPLTDEPLPSTSTPQQS
SHADGGVVHVDSDDDITIDETRSAPRNHPSHGTTFEDDAAMARRLQEEMYGGRDAEEGVR
APMARTTETLVGPEADFDDGDMHASILGQLRARQQRNNRPGIFNQRDTSIWTGDDETSQR
ERLAAATGGASEASNKSNMLAEMYRPPFDIMSRLPWDLARQEGRDNERWLMVNIQDPSVF
DCQVLNRDLWKDPAVKETVKEHFIFMQYSKDDPRAGPYLQYYFQASDVSDNYPHIAIVDP
RTGEQMKVWSGPPVIKASDFLMQLHEFLDRYSLKHNVRNPVAKRKPEMKEKSIDAMTEEE
MLEMAMRNSLGDEASQPPKVEDPDDLTRSTEDVKGKGRAIDEDVGMEETEGPEQNAFSSI
PDDRFHTEPPADPATTTRIQFRHPSGRVIRRFALSDPVQRIYEWLKAEPPLADKAGVEFE
LNAMGRNLIDSLGQTIADAGLKNGTVMIGYLEE
Download sequence
Identical sequences A0A1R3RGW0
jgi|Aspca1|24171|fgenesh1_pm.00626_#_66

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]