SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|25509|fgenesh1_pm.00772_#_141 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|25509|fgenesh1_pm.00772_#_141
Domain Number 1 Region: 56-214
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-53
Family NQO2-like 0.0000916
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|25509|fgenesh1_pm.00772_#_141
Sequence length 269
Sequence
MASKFFPAVPRTGRQLFQQIPKTQFRPFSAGPQRYSDSLAVHRNKGDNNPSVPFKFSDQS
LKLIDEILKRYPPQYKKAAVMPVLDVGQRQHGYTSISVMNEVARLLEMPPMRVYEVATFY
TMYNREPVGKYFVQLCTTTPCQLGGCGSDKIVQAITEHLGITPGHTTKDGLFTFIEVECL
GACVNAPMVQINDDYYEDLTPESIKTLLTALKESSTALEAGQTVKVPAPGPLSGRDTCEN
SAGLTNLVEPVWDPATMMRKDGALDEQTQ
Download sequence
Identical sequences A0A1R3RDC8
jgi|Aspca1|25509|fgenesh1_pm.00772_#_141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]