SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|25885|fgenesh1_pm.00815_#_98 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|25885|fgenesh1_pm.00815_#_98
Domain Number 1 Region: 8-192,288-381
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.19e-47
Family FAD-linked reductases, N-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 636-798
Classification Level Classification E-value
Superfamily MAL13P1.257-like 3.66e-44
Family MAL13P1.257-like 0.0015
Further Details:      
 
Domain Number 3 Region: 421-630
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.25e-40
Family Glutathione peroxidase-like 0.0026
Further Details:      
 
Domain Number 4 Region: 199-293
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.41e-28
Family PHBH-like 0.00018
Further Details:      
 
Domain Number 5 Region: 803-864
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000000068
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|25885|fgenesh1_pm.00815_#_98
Sequence length 875
Sequence
MAPSQQEKYDIVIVGAGPVGIVLSLCMSRWGYKVKHIDNRPVPTATGRADGIQPRSTEIL
RNLGLKRQIMAFKPAKVYDVAFWDPLADGQGIHRTGSWPSCPRFIDTRYPFTTLVHQGKI
ERVFLDEIEKAGTTVQRPWTIIGFKNDGLDETYPVEVQLKSIDTNVIETVRTKYLFSGEG
ARSFIRQELGIKIQYKDPISYVWGVMDGVVRTNFPDIETKCTIHSDAGSIMVIPREDNMV
RLYVQIASSSDPDFDPRKTATAEEVQAIAKKILQPYWVEWDRVEWYSVYPIGQGISEKYT
LDERVFMGGDACHTHSPKAGQGMNTAFHDALNMAWKLHAVESGLAKRSILSTYESERKDI
AETLLSFDNKYAALFSKRRPTAGEVGEASHTAATNGEEDEFVQTFKSSCEFTSGYGVAYK
PSVFTWDPSHPAQSALFNIPGVKLTPGRAFTPTTVTRLADANFVHLEQEIPANGAFRIFV
FAGKQDKTNKAIADLAANLEKERSFLSVYRRSDIADVSFFEHHLPHSKLFSICLVYAGEK
NQIDVEAVPMILRDYHHHIYADNIPDVRVPQATFAAHEKLGFDPEKGGVVVTRPDSHVAC
TVQLVEGSGTVDALNAFFGSFTAKPLGQDQQHSRLVTDLRPQDTEDDPYYYTFKVQCTSC
RETHPNWVSFNRFVSSVSPSTYQARSSRCMQEQHEIPGSRGEANFVWKCKLCQKTHSASI
TAGPHAYEADEKRKGKTVIEIDCRGLEFVDFKADGEWEAKGIESSTPFTGIEFADEEWYD
YDEKAGDEVAIKEISWQIGRARVGTELVIRLKWGQTEYKGKLESIDSYMNVLLRDTEEFI
DGKNTGTLGLVLIRCNNILWMGSADSVEMTDLGLR
Download sequence
Identical sequences jgi|Aspca1|25885|fgenesh1_pm.00815_#_98

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]