SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|25931|fgenesh1_pm.00815_#_144 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|25931|fgenesh1_pm.00815_#_144
Domain Number 1 Region: 167-255
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.07e-26
Family Thioltransferase 0.0002
Further Details:      
 
Domain Number 2 Region: 4-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.28e-20
Family Thioltransferase 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|25931|fgenesh1_pm.00815_#_144
Sequence length 272
Sequence
MSALLEVASEAEFPTIISSLPPSCLQVLYFHAPWAAPCAQMRAVLSALASQYPATTPPSI
AFLSVNAEELPDISEEYNVTAVPFVVLVRDNKILETISGSEAIQVRDAVERHAGAAAADG
LPKTTTIPPPLTAVPRENVSATATQTPANGTTTAPALTPEQSKEALFARLAELVKAAPVM
LFMKGTPSSPQCGFSRQLVGILRERSVKYGFFNILADEDVRQGLKEFADWPTFPQLWVEG
ELVGGLDIVKEELENDPEFLGRFSVNKGPAAA
Download sequence
Identical sequences A0A1R3RAN5
jgi|Aspca1|25931|fgenesh1_pm.00815_#_144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]