SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|26172|fgenesh1_pm.00855_#_173 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|26172|fgenesh1_pm.00855_#_173
Domain Number 1 Region: 11-93
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.58e-22
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|26172|fgenesh1_pm.00855_#_173
Sequence length 94
Sequence
MSSKYAFTKGLKELRFLFCQTSQDSAATRSFLQRAYPTMKKHNPYTPILIREAAGTVPRV
YARYGLGQEKQAALTGLTDQQIEEKITQLVKESS
Download sequence
Identical sequences A0A1R3RGC9
jgi|Aspca1|26172|fgenesh1_pm.00855_#_173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]