SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|26179|fgenesh1_pm.00855_#_180 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|26179|fgenesh1_pm.00855_#_180
Domain Number 1 Region: 40-224,341-444
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.57e-50
Family FAD-linked reductases, N-terminal domain 0.0000511
Further Details:      
 
Domain Number 2 Region: 494-660
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.23e-33
Family Glutathione peroxidase-like 0.0011
Further Details:      
 
Domain Number 3 Region: 227-347
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.65e-26
Family PHBH-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|26179|fgenesh1_pm.00855_#_180
Sequence length 663
Sequence
MPVFTEYATSTRELRVLPSFAPPLPRLSPICPHDGRYERYEVVIVGAGPAGLMLNLLLAR
YGLTDESLLCVDAKSGTLKSGQADGLQPRTLEVLKSLGLADEILNDGCHMEEVAFWNPSP
NTDEVIERTAIVPDVAVPARFRHEITIHQGRIERILETDLLRYSRRGVQRNTQLLSVAID
EGGDAEFPVVAEIETDGHRRTVRSKHLVGADGAHSVVRRGMGLNLVGESLDHIWGVVDLV
IDTDFPDIRRRCAIHSPAGSVMVIPRERIATGDYLTRLYVQVPEEAPPDDDRKPVNRTTL
KDARARRGQVTLDGIFQHAAEAFKPYYIRPKEAGAVDWWAAYQIGQRVSNQFTVKDSKGI
NRVFIVGDACHTHSPKAGQGMNVSMMDSYNLAWKLVYTIHGLTADSSSPGKPDAVLDTYH
TERHTIAQELIEFDRAFSSMFSGNIGAAEDGVGSLTHEQFLEVFSTGNGFTSGCGIEYPD
NLTVQKTLDQGTKNPVEGTDYLSGILRPGRRLLNVQYRRHADGNRRHLHDDFLSTGRFRI
LCLTSADLLDPKGVSALALRTLGSFVLPRFPPSVIEQVVIHPRLPRDFTWRDTPAELKKH
SEMSFYSGYEMDDVYKIYGVDVAQGALAVVRPDGYVGMVAALDDVKRVEEYLERCLRTVQ
TAT
Download sequence
Identical sequences A0A1R3RGC8
jgi|Aspca1|26179|fgenesh1_pm.00855_#_180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]