SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|26438|fgenesh1_pm.00866_#_163 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|26438|fgenesh1_pm.00866_#_163
Domain Number 1 Region: 455-636
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.54e-43
Family Glutathione peroxidase-like 0.00017
Further Details:      
 
Domain Number 2 Region: 8-203,319-395
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.03e-43
Family FAD-linked reductases, N-terminal domain 0.00075
Further Details:      
 
Domain Number 3 Region: 210-301
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.31e-25
Family PHBH-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|26438|fgenesh1_pm.00866_#_163
Sequence length 639
Sequence
MTLGAAEQFDVVIIGAGPAGLMAAVWMAQTGVKTLVIEEKLGRTLTGHADGLGSRAFEIL
NSFGLGESIWMESNRTIDVCLWSSSRGGLQRNSVSPNNNPGWSRFQEATLCQGRIESYLL
NFVKRHENVTIEWATVPTSLEISKDKTETPGFYPIGLRTKSSSMQADEQPRKSKIEPERT
VQAKYLIGCDGAHSWVRKQLGLALEGDRTPDEHWGVIDCIPITNFPDIRKRCIIKSDGGN
LMIIPREKKLVRFYIQISPTVAESFKANYCPSALMTVLKNILRPYTFDTSSTEWSTIYTV
RTTHTPADEKALRINAADVFKVGQKLCNTFSVRDRIFLAGDAVHTHSPKAGQGMNLSSVL
KGIATPEVLCTYQAERFPVAKRLVAFDRRMCSSVCSTTEEEDPNSSSDRFFDLKSTLSEE
NTCASGLGVVYGPGLLVTPSDNQNSVPCVDGTNLCCPHSKPYLARNIVVGGRLPSQSVLC
QSDSHPWHLQDRLVSTGQWHLIIFGGNITDFTQMTRVKRLTDSLSHPQSLVNRIVLTDGS
PVGSVATYMVHSAPREEVEFMDLPPILRPFDDVTGYDYSRVFADNKVSEEGCGCAYQNYG
IAPEGCMVLVRPDQHVAFIGALEDTHALFKFIAKSFVVR
Download sequence
Identical sequences jgi|Aspca1|26438|fgenesh1_pm.00866_#_163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]