SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|26617|fgenesh1_pm.00866_#_342 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|26617|fgenesh1_pm.00866_#_342
Domain Number 1 Region: 263-367
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.6e-29
Family PDI-like 0.02
Further Details:      
 
Domain Number 2 Region: 56-184
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.04e-24
Family PDI-like 0.022
Further Details:      
 
Domain Number 3 Region: 376-488
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000405
Family Thioltransferase 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|26617|fgenesh1_pm.00866_#_342
Sequence length 732
Sequence
MRVSLLAWSLLSLVSIPTLAAPSNDVSPSHHLVKRDGSSDAKSELQSTTFNGIEVPPIKA
LGPDNFEETVKDGYWFVKQYSPSCPHCQKIAPTWQTLYEFYYTSDPLSSSSSKSPDTESL
NSFHGFYNFHFAEMNCLAHGDLCRKLDVKYFPTFALYHNGELVEQYTGKKSMEGLSEYVE
DKLEQIKPGSRPAQGLNLPKPGDKGVDTKAEPDTPVAKDKDREAGAKAGEKHNEQAAQLA
VEDEPADKTSSKSKPKAKPAPANPQGISVPLTAESFQKLVTTTRDPWFIKFYAPWCHHCQ
ALAPNWREMAKEMQGVLNVGEVNCDVESRLCKDARVSAFPTMYFFRGGERVEYTGLRGLG
DLISYAKTAVDVGSGVQDVDATTFKELEEKEDVIFLYFYDHATTSEDFEALERLTLSLVG
HARLVKTNSAALAERFKISTWPRLLVSRDSRPSYYNALAPKDMRDFRQILNWMRTVWLPI
VPELTASNAQEIMDGKYVVLGILSRKHSDEFLQSKRELKNAALEWMDKQTQLFQLERAEL
RDAKQLRIEEAEDRNDQRALRAAKNMRITIREDDKKQVGFAWVDGDFWERWLRTTYGIDV
ENGERVIINDQDNRRYWDTSSSGASIMASRTSILETIPLVIANPPKLTPKSTVGTFESVF
FFTRSFISGHPIIFFILLTLSVAGATFMARGRAARRGGRGGILGVTGNTGGGFFNLDGKE
GLLNGGSTGKVD
Download sequence
Identical sequences A0A1R3RZ70
jgi|Aspca1|26617|fgenesh1_pm.00866_#_342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]