SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|26779|fgenesh1_pm.00866_#_504 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|26779|fgenesh1_pm.00866_#_504
Domain Number 1 Region: 6-165
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.93e-56
Family Glutathione peroxidase-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|26779|fgenesh1_pm.00866_#_504
Sequence length 194
Sequence
MSSATTFYDFEPVDKKGNAFPLTSLQGKVVLVVNTASKCGFTPQFQGLEKLYQDLKAKYP
EDFTIIGFPCNQFGSQDPGSNDEIQSFCQINYGVTFPVLGKLDVNGDKAAPVWTWMKEQQ
PGLLGLKRIKWNFEKFLISADGKVVGRWASLTKPESLEEPILKELEKAKKEGTLASLKQA
GEGEAQGRVFVIPC
Download sequence
Identical sequences jgi|Aspca1|26779|fgenesh1_pm.00866_#_504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]