SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|27561|fgenesh1_pg.00009_#_372 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|27561|fgenesh1_pg.00009_#_372
Domain Number 1 Region: 445-582
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.36e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.0031
Further Details:      
 
Domain Number 2 Region: 369-471
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.06e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|27561|fgenesh1_pg.00009_#_372
Sequence length 600
Sequence
MDHPSLTSEADSVLHTTTSTLLHPSLTSVAEDASTLAAQHQEPQLDPTQGQDQVSIDEDS
LHGIQCAVEGLDYSRPSQHPQQQHDIHPHHQQQELQSLVKRPDQHVDIRTILDPPDLDAW
RDRLFNVDEMIVLSEEQFLTYFPHIDNVYSHRSTQHYKRKPLISHYWDCRLKGRPPGTPK
SNDPNKKKRKRTARQRDLCDVKIKITEYFPGHDVMGSSGTDAGLSVLGVGVSGSLPGAGG
SMLHLTAESALRDQQNQPFGLLTPSLNPPLPEGHPGVNGQRFFTIQRVNGNGANGKNDGV
SGGHRHTLEESDRVKKNSVQRYLLKEVREKKRSLSTRAMSTQNETQKQYHTKATGLAART
VANRSQDNELKLYGSCFCPFVQRVWIALEVKGIPYQYIEVDPYKKPQSLLDVNPRGLVPG
LRHGDWGSYESSVLLEYLEDLNVGPALLPPGDAKLRAHCRLWTDFINRHIVPNFYRVLQE
QDTQKQVSNAQELRDEFNTLVTAADAQGPFFLGPRVSFVDVQVAPWIIRLRRALKPYRGW
PDPEPGSRWGAWVDAIENNEHIQATTSTDELYLDSYERYAQNRPNTSQVANAINSGRGLP
Download sequence
Identical sequences jgi|Aspca1|27561|fgenesh1_pg.00009_#_372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]