SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|31684|fgenesh1_pg.00168_#_51 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|31684|fgenesh1_pg.00168_#_51
Domain Number 1 Region: 1-166
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.95e-26
Family Glutathione peroxidase-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|31684|fgenesh1_pg.00168_#_51
Sequence length 166
Sequence
MALKPGDYFPSDVVFQYIPWTEESGEITACGIPINYNASKEWADKKVVLFSVPGAFTPTC
SINHVPGYIQNLPQLKEKGVQVVAVIASNDSYVMSAWGKANNVKGDDILFLSDPDARFSN
TIGWANGGRTGRFAIIIDHGKVTYAQIETERGVVKVSGADAVLAHL
Download sequence
Identical sequences A0A1R3RQT7
jgi|Aspca1|31684|fgenesh1_pg.00168_#_51

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]