SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|32629|fgenesh1_pg.00609_#_270 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|32629|fgenesh1_pg.00609_#_270
Domain Number 1 Region: 229-352
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000425
Family Thioredoxin-like 2Fe-2S ferredoxin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|32629|fgenesh1_pg.00609_#_270
Sequence length 365
Sequence
MQAFIQRGRSFFTPTPSATPQDSPKGSPKVGDVVEEFKQAPSADTLFPKTDPSVDGEECL
HDCASCTVKYPAKFDVDQEDNMYGNINGWSTHVLVATGKTDWVRDVADEEGSVMEAIEKG
GLVPSNGTHLQKLKLSASNMPVPDEYHYHESGKQPTTVLVLPSFTIVDHVTPALAPDLIK
YFVNRSPTTTTALGAVVESTEETENAEQPSPSSEDIQSLTTLQSRPCPHSAVILLCSHRT
RDARCGQSAPLLRKEFERHLRHLGLYRDLDDERPGGVGIYFINHVGGHKYAANVIVYRRR
DFDWHKTAGEAETSGEGAAQGIWLARVRPQDCENIIRYTVLQGKVVKPEEQLRGGFDRAT
GLTSW
Download sequence
Identical sequences jgi|Aspca1|32629|fgenesh1_pg.00609_#_270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]