SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|33317|fgenesh1_pg.00710_#_29 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|33317|fgenesh1_pg.00710_#_29
Domain Number 1 Region: 140-266
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000291
Family Thioredoxin-like 2Fe-2S ferredoxin 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|33317|fgenesh1_pg.00710_#_29
Sequence length 273
Sequence
MAAYAQQLLVCTGQPDWTSRIEEDGQDQNWGELVRGLKRLLGRGGKYADPFNNVLVTNSS
FLPSSSTSTATSQTASAFLFPSFKYFPSIPVNLSESTDFKTDVSTFVRAFLLPSESRHGG
KTREDGLASEFPDAVDLQHSPVVLICGHGGRDMRCGVMAPVLEKEFQRVLQSKGFASAGS
DNSVIDHPDHAHIGLISHVGGHKYAGNVIVYIPPGMKEAGSSVVHPLAGKGIWYGRIEPK
HVQGVVEETILGGKVITDHFRGGIDHDGGILRL
Download sequence
Identical sequences jgi|Aspca1|33317|fgenesh1_pg.00710_#_29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]