SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|34316|fgenesh1_pg.00772_#_92 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|34316|fgenesh1_pg.00772_#_92
Domain Number 1 Region: 372-715
Classification Level Classification E-value
Superfamily Thiolase-like 2.71e-63
Family Thiolase-related 0.00048
Further Details:      
 
Domain Number 2 Region: 868-1004,1071-1175
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.8e-53
Family FabD-like 0.003
Further Details:      
 
Domain Number 3 Region: 2114-2293,2423-2524
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.18e-44
Family FAD-linked reductases, N-terminal domain 0.0047
Further Details:      
 
Domain Number 4 Region: 3028-3245
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 8.44e-32
Family Plant O-methyltransferase, C-terminal domain 0.0022
Further Details:      
 
Domain Number 5 Region: 1800-2050
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.43e-28
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.016
Further Details:      
 
Domain Number 6 Region: 2842-2935
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.07e-16
Family Plant O-methyltransferase, N-terminal domain 0.051
Further Details:      
 
Domain Number 7 Region: 2296-2429
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000000000000031
Family PHBH-like 0.0013
Further Details:      
 
Domain Number 8 Region: 1713-1794
Classification Level Classification E-value
Superfamily ACP-like 0.00000000000249
Family Acyl-carrier protein (ACP) 0.071
Further Details:      
 
Domain Number 9 Region: 1603-1681
Classification Level Classification E-value
Superfamily ACP-like 0.00000000327
Family Acyl-carrier protein (ACP) 0.016
Further Details:      
 
Domain Number 10 Region: 2606-2742
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000649
Family Glutathione peroxidase-like 0.0063
Further Details:      
 
Domain Number 11 Region: 1005-1070
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.000011
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|34316|fgenesh1_pg.00772_#_92
Sequence length 3248
Sequence
MDARRIIFFGGQGSRALSVSPFHPSEDDKACDSAISLLLSVCHSALLQEAMQHRRREPLP
AWADFDLPTNAGLLVSGNAMASDNAILQGVALCVHQLVAYLHFDSTLQKKRTSTLLGFCS
GIVPAIVLACSSNVQDYIQYSKEAVRLTYWIGYRAAELTAHLMPDRNLPGSWALSVFGKD
RETLEADLERFNVAYGGTFNLRLATCFGKDCFTIVGPPLSLNRFRSQCLGEQHPSEAIRI
HALYHAGEKGCEGLLKVLDDAHRESIQFPTLDQIKTALWTCHGNSSLDRKSLFGSSSLLE
LAVRLILVDAADLYNTWKVITDNMLALSCDREIITVGPGSSALLVSTTQDTRTPNETKWI
NLSGVGAALKSAQEGFAIVGMSVNYPGASGKDEFWALLENGLSAMQEIPSSRFEVQNYSS
DTPECRPPREMKARHGNFLADPFAFDHEYFGISPREAKSMDPQQKLLLQGAVHALDDAGY
VPNVAPSFNPDTMGCYIGAATEDYVLNSMPHIDVYYSTVSIVLACRALMQGDCTAALAGG
VNAITSPDMYLGLSRAHFLSPTGQCKPFSTAADGYCRAEGCGLFVIKRLQDAIQEGDRIH
GIIRGAEMNQSGRASSITHPHAQTQQELFQKLLARTKVDPTTIGVIEAHGTGTQAGDAVE
TSSIDCVFSTRTTPLYLTSVKGNIGHAEAASGSAGLAKILMMLRHSKIPPQVGLGVRNPC
LDKLDSSNIRIPTTICDWNRAMPSIPKRALLNNFGAAGSNAALMVEEYRPSFPAKGPQYA
RRAAYNLILSATSPGALQNLVDLYMAMLGNNISGFELQDICFTATARRQRHKYALSIVAG
TRAEMMQQLQQAQQCNNQILESNRTHPIVFVFSGQGGAYSGMGRELLHTAPVFRQKVTEC
EGILHEKGLPELCPTQILNGDFIPSETAEDGGAEWLAYSQVACFVLEYALASLLISWNIQ
PDIVIGHSLGEYAALVVAGALSLEDALPLVAHRATLMASKCEVGKSTMLACCQSASFTQR
IIRSSGLSHLSIACDNEVMSCVVAGPIGEIDRLQEIMGAEQIRCKRLPVSLGFHSPALDP
IIDELNQLTRDIRFSEPEIPVGSGLYGELHKSPIDGSYVGRQTREPVNFTGLVDFLAGIE
ELQRATFIEVGPTPITLPMFRSQLSGPSTAFLNTLVKGQDAWSSLCGCLRDFNARHDSVQ
WRNVFHGTSAKVVDLPDYPFQTQSLFFSFHEGVSEVRAYANSGHDMGQIRPSIFRLLQKV
ISLSAGPDNSLSVFGTTSRDLVEYINGHKVAGMSLCPASVYCGMVLEGLYCNREVGGQRL
ATFRNISFDHPLVHTSNDDIRSIHLTLKDLRSDVGMTFSHTQFTFISASSSGSASETVLC
SGQTSWMPLSDINSILGRRAAYAQKQIALLRRNQSQTSVLHRKVIYDTIFTRVVRYSDPY
QSIQVFHVSEAGLDGYGTFQVPQSTLGGGVMSPVFLDTLLHAAGFIANAQGGPSDAFICH
SVESAVVTYSDIKPTDTYRFYCGLLDCGGGELLGETVAMNSDGKAVASVEGMHFKRLNLK
AFTAHLSRQSGQETQVPRPGNALSSSAYPRPGHTSSSMGKTPDTTKFVLDAISTVCAIPP
SQVGLATRLVDLGFDSLMQVELWDLLGKHLPAPPKGLSFEVGTVEDIVSHFLGPMNTSST
ASSLQSGITECSPNDSVCTSITDEAEKSMPGGDAVTDRLLGLVAEICGLGGSDLDAAITM
DSLGLDSLLTIELQASVRDVFGISLPLGMLSPNTTIGMLATSIAAETRPVTPEAPSVVFD
RQAWTPDHDWIVLLQQGADTLPPLILVHDGSGTVEQYRRLSTVGCTVFGIRNPMASGSVH
WASGLTDMACRYAAAIPTVVKGRRVVLGDSSGMLTSLAAITGWSFGGVLAHEIAQRLEQC
GYDTLGVVLIDSPSPLDHEPLPSAVVDHILNAEILSPSTKTTLAAQFKCHAQFLADYRIN
GSPPPPHRRYIMLHSEQPFDTWGVCGQRYLWLESQEERLASLRKWETLLGRPLTTYNIPG
NHFQPFTRDNASHKDDNQLDSDTPTYELPPSVEVITSPQHNSLGFNVLRTWPTLFNGTAS
PHGVPDWWKPSETVDVLICGAGPSGLEMAMSCLRQGLSFRIIDQNALPLAAGRADGVQPR
YLETLSTWGLASEVHEEGPLIERTAIYHDGHLVHHGRSHQSDSRYRGLHIITQGQLERIF
VRDLMRHRVLVERETTLEEYSVRGGDDNDEAPVRCTLVHQDRDGNPSREIVMTKFLVGSD
GASSAIRRQLKIPFDGISTDLYWGIMDCVFDTDYPHAWIFGYDNADQNRSSVIHSFTHTP
TRSVISSQHGGCVIIPRENGYIRLYTQLNLSQTGPIAASRQARESGGQIDVHSITPEEVL
EQANRIFAPFTLRFAAPLSWFAVWKISERVARSFSSKDLRVHLVGDAAHVHSVMGAFGLN
ASILDAANLGWKIGLCVKGKARIDRLLSTYDRERRLHAANIIEVSGKYLRFVCSSHVPTV
RLHHVGADLGLEEEGSSGTQRMPVPSAEAISITPTDVDRGGHDQHALEMREVQAVLQEFF
TQHGQFLLGVDASYGRSCLNPLSKYHHRAPVRVRNGVRAPNPRVCLDADHTGYLYDRLPG
DGRFHLVVFGSNLRGPVREQLVNFSRALLSDEGFYRRLGGHETFNLVLVAKGVPWEVESR
LSQDHALHALYQTATMLFDDRAPDDDAHSTWGVDHQTGAVVVATCLHNLHVYPSTFTPTP
THVTLTNEVIRGDRPATMPTLSDAHALLQLLDLTKQSVHQIIAEWAKVPKPDDPSERGDE
LPSRELFEAQRTLLAATGKLVELVSNPSGRLLEVSSQYNESRCLHIAASLRIPDLLAKNP
PQEGVTLEELAAMVGVERKKLGRIMRCLCSIHIFQEIGDGVFANNLVSASLVDNDPLRAY
IVMFGWDLYSASEALPQSLLDSDHGPSYSVSETAWQRAVGTTKTRWNWLEEEIDQPPPTG
QSGYSGPFSPDLPVASLRRPELEIFGLAMMGGGRVFGRAHLFDYPWGTLGPGSATVVDVG
GGVGGFCLQLSHLHSHLRFIIQDRGPVLYQAEHDVWPRENPRALAGGLVEFVVHDFFDPN
PVIGADVYWLRYILHDWSDDYCVRILINIRTAMRSHSRLLICEQVMHTTAPRPAETAGIA
RAAPAPLPANYGYWARYSHQRDIAMMSIINGIERTPAEFSELVARAGLRMHKIWDCRSPV
SLVECILP
Download sequence
Identical sequences jgi|Aspca1|34316|fgenesh1_pg.00772_#_92

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]