SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|35184|fgenesh1_pg.00855_#_319 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|35184|fgenesh1_pg.00855_#_319
Domain Number 1 Region: 42-225,326-429
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.57e-45
Family FAD-linked reductases, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 486-611
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.35e-24
Family Glutathione peroxidase-like 0.0016
Further Details:      
 
Domain Number 3 Region: 222-332
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.92e-19
Family PHBH-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|35184|fgenesh1_pg.00855_#_319
Sequence length 613
Sequence
MPVFTEFSSKSRDLRVLPSFALPLPRLTLPFQRTRNDGVERYEVVVVGAGPAGLMTQLLL
ARYGLSDDSLLCIDSKESTLKSGQADGVQPRTLEVFKTLGISDEIENEACQMWQFAFWNT
SMDTSKTIERKSVVPNVVPPARFRYEATLHQGRIERIMETDLLRYSKRGVQRDTKLLHVQ
IDEEDPEFPVLAEIETRGVRSVIRTKHLVGADGAHSTVRKYMVVDTNFPDIRRRCAIHAP
AGSVMVIPRERIVTGEYLTRLYVQVPGLAKPENDVTPEGSSLELSVEDARIRRGQVTLEE
ILKQASDAFKPYYLRPKKASIDWWAAYQIGQRVSPEFIARDSAGVPRVFIVGDACHTHSP
KAGQGMNVSMMDSYNLAWKLAYHIHGLSPASAEQGKPDPLLDTYHLERHANAQQLIDFDR
KFSTIFSGQLDTDESGMSHTQFVETFNTGNGFTSGCGVEYAENMIVVREPSDGSASPVHG
DDYLSDLASNGRFRVLILTSDDLLNAQGVSARALHDVATLLGSFPAEVIEQIVVHPQLPS
DFDWETIPTCVKEQAEMRFYNGQDLEDAYTIYGVDPGQGALVVVRPDGYVGMVAQLGNVN
RVKEYLGGCVRSI
Download sequence
Identical sequences jgi|Aspca1|35184|fgenesh1_pg.00855_#_319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]