SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspca1|35677|fgenesh1_pg.00866_#_484 from Aspergillus carbonarius ITEM 5010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspca1|35677|fgenesh1_pg.00866_#_484
Domain Number 1 Region: 6-138
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.06e-33
Family spliceosomal protein U5-15Kd 0.00000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspca1|35677|fgenesh1_pg.00866_#_484
Sequence length 143
Sequence
MGSVVLPHLRTAWHVDQAILSEEDRLVVIRFGRDHDVDCMRQDEVLFKIAERVKNFAVIY
LCDIDEVPEFNTMYELFDPMTIMFFYRNKHMMCDFGTGNNNKLNWVLEDKQEMIDIIETI
YKGAKKGRGLVVSPKDYSTRYRY
Download sequence
Identical sequences A0A100I9C7 A0A146FDT9 A0A1L9N7Q1 A0A1L9UWC3 A0A1L9X9G1 A0A1M3TRY8 A0A1R3RZM9 A0A2I2EDQ3 A2QDS1 G3Y3U1 G7XPR1
jgi|Aspbr1|38359|fgenesh1_kg.2_#_707_#_Locus6919v1rpkm15.96 CADANGAP00002262 e_gw1_2.2070.1 XP_001399942.1.80561 XP_020061410.1.76396 jgi|Asptu1|41558|fgenesh1_kg.3_#_919_#_Locus7452v1rpkm15.76 jgi|Aspfo1|42686|fgenesh1_kg.3_#_750_#_Locus5406v1rpkm23.09 5061.CADANGAP00002262 jgi|Aspca1|35677|fgenesh1_pg.00866_#_484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]