SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn001961 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn001961
Domain Number 1 Region: 308-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000435
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  Achn001961
Domain Number - Region: 266-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0121
Family EGF-type module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn001961
Sequence length 393
Sequence
MTLHVFLLSLSFLLLSRTTSANHGTNTTAAAANTTFPPGFMVSKPDCPQKCGNLTVPYPF
GVGVGSGCSIGPWFDVNCTSNPPTAYINTGNLDIVDISDTHIRIKSVVASRCYAQSGLMT
QDNPAWTQLGDTSPFTFSDTLNKFTVIGCDDFALISGSLPRNFTSGCVSLCSKKEDVLDG
YCTGIGCCQTSIPKGLKNFYTQLSSLANHTKVWSFDPCSYAFVGAQDIFTFRGASDFSDL
GFMNRTMDTVPVVLDWAIGNQTCVEAQNSSDYLCQKNSVCTDHDRGNGGYRCSCNEGFFG
NPYLSPGCQDIDECADPNSNDCDDHAICINTPGSFNCSCVKGYLGDGRKDGHSCIAKSSQ
FPVIKFSLGLAIYRSRSDIGRRKGREGVGSILS
Download sequence
Identical sequences Achn001961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]