SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn001971 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn001971
Domain Number 1 Region: 309-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000174
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  Achn001971
Domain Number - Region: 275-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00766
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn001971
Sequence length 409
Sequence
MALHVFSLSLSFLLLLSPPTSATHTTNTTTAAANTTVPPGFMVSKPGCPQKCGNLTVPYP
FGIGIGSGCSIGPWFDINCTSNPPTAYINTGNLDIVDISDTHIRIKSVVASRCYAQSGLI
TQDNPAWTQLGDTSPFTFSDTLNKFTVIGCDDFALISGSLGRNFTSGCVSLCSKREDVLD
GYCTGIGCCQTSIPKGLKNFYSLLSTLANHTKVWSFDPCSYAFVGDQDIFKFRGASDFSD
PGFMNRTMDTVPVVLDWVIGNQTCVEAQKSSDYLCQKNSVCTDFDSGNGGYRCSCNEGFF
GNPYLSPGCQDIDECADPNSNDCDDHAICINTPGSFNCSCVKGYLGDGRKDGHSCIAKSS
QFPVIKFSLVIITIFADDGSSVVVIVVTDSSIVTIDVNHQSISNKDKKI
Download sequence
Identical sequences Achn001971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]