SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn003921 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn003921
Domain Number 1 Region: 27-163
Classification Level Classification E-value
Superfamily PA domain 0.0000000209
Family PA domain 0.0068
Further Details:      
 
Weak hits

Sequence:  Achn003921
Domain Number - Region: 502-548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0297
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn003921
Sequence length 826
Sequence
MEFLRVLLVISLLLGCARSRFVVEKSSISVIAPHDLASKHDGAIANFGVPDYGGSMVGSV
VYANKGSFGCNPFDGDKPFKSKTHLPTILVLDRGECYFALKVWNGQQAGAAAVLVADSID
EPLITMDSPEDSSNADGYIDKISIPSALIKRSFGETLKAALKKGDDVVLKLDWSESLPHP
DERVEYELWTNSNDECGIRCDEQMDFIKNFKGHAQILEKRGYAQFTPHYITWYCPQAFTL
RSQCKSQCINHGRYCAPDPEQDFGEGYQGKDVLFENLRQLCVHRVANESKRSWVWWDFVT
DFHIRCSMKQKRYSKECAEDVMKSLDLPVDKIKKCMGNPEADEENEVLKVEQERQVGRGS
RGDVTILPTLVINDAQYRGKLERNAVLKAVCAGFKETTEPRICLSGDLETNECLDKNGGC
WQDSKSNITACKDTFRGRVCECPLVNGVQYKGDGYTSCQAVGPGRCTINSGGCWSETKNG
KTFSACSESDLSGCRCPSGFRGDGHTCKDIDECKEGLACQCDGCTCKDTWGGYDCKCKGI
YVADQDTCIERNASKFGWFITFLVLAAVVGAGIAGYIFYKYRLRKVESEDQAITAAEGEA
SMGRVDFQKDTYQIPPRTLDILQTDSSLKRSDEEVALLDTYATIKSPLVLNTGRKPYRKR
ALSPQDEESSDVDLSCPQCGLGCDRAFCGAYWHAQRVTESNSHPVCSHETLKTITERCIG
QMGRTLQDVISDWITKLNNREIDRTRLPLNHAEMITAGTNLCNDCYDKLVSFLLYWFRIS
MPNHLPPDATQREDCWYGYACRTQHHCEEHARKRNHVCRPTKGSHM
Download sequence
Identical sequences Achn003921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]