SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn006491 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Achn006491
Domain Number - Region: 3-81
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00151
Family PAPS sulfotransferase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn006491
Sequence length 84
Sequence
MVAKALESFKSTRHIILYYEDIIKNRSKLIEVQDFLKVPQMDLKSRQVKIHKGSLSQRVE
NWDDIEKALKGTPYESFLHEDYKI
Download sequence
Identical sequences Achn006491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]