SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn009011 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn009011
Domain Number 1 Region: 476-763
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-75
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 79-187
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.89e-27
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Domain Number 3 Region: 1013-1116
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000342
Family Protein kinases, catalytic subunit 0.0043
Further Details:      
 
Weak hits

Sequence:  Achn009011
Domain Number - Region: 356-402
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00118
Family Hairpin loop containing domain 0.043
Further Details:      
 
Domain Number - Region: 835-877
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00141
Family Hairpin loop containing domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Achn009011
Sequence length 1136
Sequence
MSLKCKSQRLFLFVVLLFIIFFNTHLSKASNTIYSGQSLSGNQTITSQDGVFELGFFAPG
KSQNYYIGIWYKNLPNKTVVWVASRNQPISDPSSSELKLMRYGNLVLLEQSKTRIWSTNS
SSNLANSTVATLLDNGNFVLRDTNSSNIIWQSFDYPTDTWLPGGKVGYNKLRNEKQVLSS
WRSSEDPAPSLFSVEVEPNSSHVLLWNGSKLYWTSGLWDGKVFANVPEIAIDYYVKNFTY
ISNENESYFTYEAGFPTALTRFVLDVTGQLKQFVWRKEFPTWSLFWTKPPRQCDVYAFCG
AFSSCNQNVPVCECIEGFKPRTLADWELGDHSDGCLRKTPLECENRGNDAFVLVMNISFP
VNSEALTVGNIDKCQLVCLRNCSCTAYAYDNECLIWGSALFSLQKLPADDKSGRNLHVRV
AASELVGTEAKPKTKKKTVWIVFGTIGGFFTLFSSILVIVWRRRHKARDDTLERVEDSLV
VFKFRDIRNATKNFSEKLGEGGFGSVFRGTLPNSTLVAVKSLKSLKQGEKQFRAEVSTIG
MIQHINLIHLCGFCIEGKQRFLVYDYMSNGSLESHLFNKDSNVLDWKTRYNIAIGTARGL
AYLHEKCRDCIIHCDVKPENILLDGEYNPKVADFGLAKLLGRDFSRVLTTIRGTRGYLAP
EWISGEAITPKADVFSYGMVLFEIISGTRNRDSVEDEMAKYFPYRVAAKINEGEEALTTL
LDTKLEGNADVEELARACKVACWCIQDEDKNRPSMGQVVQVLEGVIEVDVHPIPRFIQGL
TDNPMRKTIKGGAKPGFEPNTLADWEFGDYSDGGVRKIPLERDNRGNDAFVLVTNILFLV
NSEALTVENIDKCQLVCLRNCSCTAYAYDNRCLICGSALFSLQKLPADDKSGRNLHVRVA
ASELVGTGAKSNIKKKTVWIVFGAIGSFFTLFIRILVIVWRRRHKARDDTLERVEDSLGD
TCQFHSGSDEVAEEPKARREAVLRRSEHHWNDPTHPSRSPLRILHSRVNTTRKWQILTTI
RGTGGYLAPEWISGEAISPKADVFSYGMVLFEIISGKRNRDSVDDEMAVYFPYRLAAKIN
EDENKDRPIMGQVVLVLEGVIEVDVHPIPRFIQGFADNPMEPFVYQENSSTSTLLS
Download sequence
Identical sequences Achn009011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]