SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn031441 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn031441
Domain Number 1 Region: 57-133
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000877
Family alpha-D-mannose-specific plant lectins 0.0082
Further Details:      
 
Domain Number 2 Region: 160-231
Classification Level Classification E-value
Superfamily EF-hand 0.000000106
Family Calmodulin-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Achn031441
Sequence length 253
Sequence
MSREKKLLISFLVLLLLQFCTPKDTITLNQSLKDVDLLVSGNETFALGFFSPGKSRNRYL
GIWYNKVTELTLVWVANQDNTISNTSEVVSVDSFRKLVIHGPDKVIPVWSTNVCGAAHSA
QLLDSGNLVMLGALFAMGVRKWVHFQDLLPIIAQKLGEEGLIRELCNGFRMLMDGEKGLI
TCESLKRSSVLLGLQDFGEDGLRNVIREGDLDGDGDRNQMEFCVLMFRLSPQLMSGTEKI
LDEGFLQDHVKHQ
Download sequence
Identical sequences Achn031441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]