SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn064181 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn064181
Domain Number 1 Region: 915-1359
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.52e-66
Family Tandem AAA-ATPase domain 0.033
Further Details:      
 
Weak hits

Sequence:  Achn064181
Domain Number - Region: 275-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family Integrin beta EGF-like domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Achn064181
Sequence length 1369
Sequence
MDYVQRWKCSWSLVATVASMVVLVSVVHVFLFPVVPSFDYLSVRHAQNSCIPINESTKGG
KDDVLNLDAWFPADLHKAVIYRSTPWKSKIGRWLSGCNPIITTIKVVENIGGKSCNRDCS
GQGICNYDLGHCRCFHGFSGEGCSEKLHLDCNYPGSKDQPYGHWVVSICPAYCDTTRAMC
FCGEGTKYPNRPVAEACGFKMSLPSELDGPKLTDWTKADLDNIFTTNDSRSGWCNVDPAE
AYASRVQFKEECDCKYDCLWGRFCEVPVQCTCINQCSGHGYCRSGFCQCDNGWYGIDCSI
PSVLSSIREWPQWLRPAQISVPDSALHVGNLVNLNAVVEKKRPLVYVYDLPPEFSRHLLE
GRHYKFQCVNRIYDDRNATLWTDQLYGSQMAFYESILASPHRTLNGEEADYFFVPVLDAC
IITRADDAPHLSMEKHNGLRSSLTLEFYKRAYDHIVEQYPFWNRSSGRDHIWFFSWDEGA
CYAPKEIWNSMMLVHWGNTNSKHNHSTTAYWADNWDHISSDRRGNHPCFDPDKDLVLPAW
KRPDINSLSLKLWARPREIRKTLFYFNGNLGPAYEKGRPEATYSMGIRQKVAEEFGSTPN
KEGKLGKQHAEDVIVTPLHSENYHDDLASSVFCGVMPGDGWSGRMEDSILQGCIPVVIQD
GIYLPYENVLNYESFAVRIQEDEIPDLIKILRGFNETEIEFRLANVQKIWQRFVYRDSIM
LEADRQKAAFGRVDDWAVKFLQLVEDDVIATVIQEAELSASMISGASRNLETAQKRGSTI
LNLKCVDAQTGLMGKSLLEFQSTKGDVLPSHKFGTHDVVVLKPNKADPGSPPLGQGVVYR
LKDSSITVAFDDIPEEGLNSPLRLEKLANEVTYRRMKDTLIQLSKGVLKGPAADLVPVLF
GERPPTVSKKDVSFTPFNSNLDHSQKDAISKALSSKNIFLLHGPPGTGKTTTVVEIILQE
VKRGSKILACAASNIAVDNIVERLVPHRVKLVRVGHPARLLPQVLESALDAQVLRGDNSS
LANDIRKEMKALNGKLLKTKDKNTRRDIRKELKTLSKEERKRQVLAVADVIKSADVVLTT
LTGALTRKLEGTSFDLVIIDEAAQALEIACWIALLKGSRCILAGDHLQLPPTIQSVEAEN
KGLGKTLFERLTDLYGDEVTSMLTVQYRMHELIMNWSSKELYNSKIKAFSSVAAHMLHDL
EGVKRTSSTEPTLILVDIAGCDMEEKKDEEDSTMNEGEAKVAIAHAKRLVQSGVQASDIG
IITPYAAQVVVLKMMRSNDDKLKDLEISTVDGFQGREKEAIIISMVRSNSKKEVGFLSDR
RRMNVAVTRARRQCCLVCDTETVSGDGFLKRLIEYFEEHAEYLSASEYE
Download sequence
Identical sequences Achn064181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]