SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn072841 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Achn072841
Domain Number - Region: 64-139
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000471
Family Pan module (APPLE domain) 0.062
Further Details:      
 
Domain Number - Region: 6-41
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0816
Family EGF-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Achn072841
Sequence length 245
Sequence
MYTTPKDQCDNYRQCGANSICRSYKSLICECLKGFIPKSQEVWSVLDWSSGCTRRTPLNC
QNGDKFMKVKAVKLPDLLNFRLEKSMKLQECKAECLKNCSCTAYANSNITSGGRSCLMWF
GDLIDIRDFIEEYIGQDIYIRFSAKFKQEKETGDNSGGINYIWNACTGLAISEYYLEEEK
INKSQAAGGRPLSSFSVDFRTEIRSSFELGHLGTSPAHNNWAGSERRRVLHPFLRSNSSV
YALIR
Download sequence
Identical sequences Achn072841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]