SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn154631 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn154631
Domain Number 1 Region: 47-156
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000111
Family Polygalacturonase inhibiting protein PGIP 0.0032
Further Details:      
 
Domain Number 2 Region: 162-211,258-287
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000196
Family Protein kinases, catalytic subunit 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Achn154631
Sequence length 298
Sequence
MPVREDGDSSGSRRRDSGEGSSGKLWKEYFPNSHDVETQGEFYCRINGLRGSIPPEIGLI
SGLGFFQLYANELSGTVPSSIYNISSLYYFTVVQNKLHGQLPPDVGLTLPNIEIFAGGMN
NLTGPIPVSLSNASRLRLIDFAEKSLTGTVPKNFGILQENGMGSKVSTLGDIYSYGILLL
EMFTGKRPTDEIFKDSQGIRSFVEMAFPERVMDVVDRSLVFEEEEDIVVDNKNEEAKIEE
IATIGNEKPQTDASSGMVDCMVSVLRVGLSCSNAMPRERMPIKVVVNKMHAIRDSFLS
Download sequence
Identical sequences Achn154631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]