SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn179421 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn179421
Domain Number 1 Region: 10-49
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000208
Family Protein kinases, catalytic subunit 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn179421
Sequence length 114
Sequence
MGIGGENWLRLMVSNFGLAKFYPADDSIVSLTAARGTLGYMAPELFYKNIGGKGETRKEE
KVMVKKMIIVEFRGMQLKPSDPPSVSKFVEMLEGNVDLLTMCPKPFVCLPRNVS
Download sequence
Identical sequences Achn179421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]