SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn198151 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Achn198151
Domain Number - Region: 78-103
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0173
Family Anti-platelet protein 0.07
Further Details:      
 
Domain Number - Region: 17-58
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0201
Family alpha-D-mannose-specific plant lectins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn198151
Sequence length 134
Sequence
MKLGKNLVTGQEWYLSSWKSDNDPARGEYTNRLDIHGYPPIVLSKSSTDLFCSGPWNGVQ
FSGPHWRPNLIYTYGVFLKTMRFMNLKECSEACSENCSCTAYSNLDIRGGGSGCLLWFGD
LIGIRYFSDNGLAA
Download sequence
Identical sequences Achn198151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]