SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn278461 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Achn278461
Domain Number - Region: 412-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00782
Family Integrin beta EGF-like domains 0.076
Further Details:      
 
Domain Number - Region: 188-214
Classification Level Classification E-value
Superfamily Atu1913-like 0.0445
Family Atu1913-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Achn278461
Sequence length 630
Sequence
MVLGNVSSTGVRRRPFSNPISNGSFRDIQGLQNAELCYLMQKNISVKLTPEQINRGPTYF
FSGNVSVEGCTSTMLWGQYCNQTVDLLSCNDTYNLTEKLLDSKLYYQTEEDVVFCTNSGG
NSCHGIGNPKIFSLDVLGLAEQITIMATNVRFNETASSNGTRNGSGITLMCYARHGTIPV
ATLHDYSASINEGPLVIRLPRVGRWYIAIHLVNFPKEIVGVQDTNSKVCYSLDWQVLQCP
EGKAGLNCTWERYTFQTVLRKNPSVPFESYYLPITARVSSDSANFPLEPLLSNASYDGNS
DYVWTYFLLDIPNGASGGNLHIHLTSESKISTEIYAKYGGLPSLDSWDYFYGNTTSNSNG
SIYFKLYDSGDELVSFYILYVRSGMWSIGLRHLNPSELASENQTAMSISLERCPRRCSSH
GTCHSVVDASGLALYSYCFCDRDHGGFDCSVEIVSHQGQMLKNHVGHMWHSICLIASNAA
AVLPAYWSLRQKFMDFWLSFMAVASTFVYLADIGEASKRTIHTIIAIVTALLAETGPTRS
TNIVIVLAIGALGLLIGWLIEFCTKFRSLSFSMELRLNIDESVWHVTIYASSFLFLCSKA
TTVADGNQRPPDGNYELTRQDSTSRVGIER
Download sequence
Identical sequences Achn278461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]