SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn287691 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn287691
Domain Number 1 Region: 93-167
Classification Level Classification E-value
Superfamily PA domain 0.0000157
Family PA domain 0.015
Further Details:      
 
Weak hits

Sequence:  Achn287691
Domain Number - Region: 510-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00137
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 297-394
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00735
Family Thioltransferase 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn287691
Sequence length 624
Sequence
MREKLGFYVCVWFFLYGFCVGRFVVEKNSLKVTSPDSLRDVYECAIGNFGVPQYGGTMLG
TVMYPTANQKACKNFSDFDLSFKSKPGGLPIFILADRGDCFFTLKAWNAQNGGAAAILVA
DDRVETLITMDTPEENDAQADYLQKITIPSALISKAFGDSIKKVLSSGEMVNINLDWRES
LPHPDERVEYEFWTNSNDECGPKCDSQIEFVKNFKGAAQILERKGYTQFTPHYITWYCPE
AFLLSKQCKSQCINHGRYCAPDPEQDFSRGYDGKDVVVQNLRQACVYKVTNESGKPWLWW
DYVTDFAIRCPMKDKKYTKECADEVIKSLGIDVKQIDKCVGDPEANVDNPVLKAEQEAQI
GKGSRGDVTILPTLVINNRQYRGKLDKSAVLKAICSGFQETTDPGICLSEEVETNECLEN
NGGCWQDKAANITACRDTFRGRVCECPIVQGVKFVGDGYTHCEASGALRCEINNGGCWMK
TQDGRAYSACIDDHSKGCKCPPGFKGDGVNTCEDIDECKEKTACQCPHCKCKNTWGSYDC
SCSGNLLYMREHDTCIGKDVNTEVSWGFIWVIILGLAVAGVGGYAIYKYRIRRYMDSEIR
AIMAQYMPLDNQGEVPNHPHHGGV
Download sequence
Identical sequences Achn287691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]