SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn327001 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn327001
Domain Number 1 Region: 6-133
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.2e-24
Family Protein kinases, catalytic subunit 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn327001
Sequence length 140
Sequence
MPTCQDFGLALLLEVFETHATTDVAGTFGYVAPEYATTCRVSDKADVYSFGVVLFELISG
KKSLDPSFSEYGNGFNIVAWAKLLIKEGRFPELLSPELWEVGHRGNLLAMLKLASTCTAE
SLSLRPSMKQVLEKLQPLNS
Download sequence
Identical sequences Achn327001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]