SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn335171 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn335171
Domain Number 1 Region: 120-180
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.35e-17
Family G proteins 0.0054
Further Details:      
 
Domain Number 2 Region: 36-107
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00000000000000818
Family Papain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn335171
Sequence length 180
Sequence
MGAPFVVRTAWLTLLVFWVLCMCCEGQKPPKNDTEPMRKRYEEWLQKYRREYKDRGEWEY
RFGVYRSNVEIIDQYNSRNLSFKLIDNKYADMTNEEFTSIYLAPALASAADLASPGGALD
PGRLRNVAVIAHVDHGKTTLMDRLLRQCGADIPHERALDNISLERERGITIASKVRTFRA
Download sequence
Identical sequences Achn335171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]