SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn341591 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn341591
Domain Number 1 Region: 9-185
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.7e-58
Family G proteins 0.00000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Achn341591
Sequence length 225
Sequence
MAFYSGDEQTEDYLFKIVLIGDSAVGKSNLLSRFARDEFYPNSKSTIGVEFQTQKMDING
KEVKAQIWDTAGQERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNV
VTILVGNKSDLKDAREVTTAEGKTLAEAQGLFFIETSALDSSNVVVAFQTVVREIYNILS
RKVIQSQELKKQDPSWMGNGKTVVLQGNGNDELDGQSKKGWCCSS
Download sequence
Identical sequences Achn341591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]