SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn341771 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn341771
Domain Number 1 Region: 265-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000559
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  Achn341771
Domain Number - Region: 230-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00545
Family EGF-type module 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn341771
Sequence length 358
Sequence
MTKPTWAQAKLGCQDKCGSVSIPYPFGMTDNCYYNEGFLITCNETFNPPKPFLQESNIDI
INISINGQLHVMQYVAYDCYDQFGRREHQTKPWISFENLKVSSTENKFIAIGCDTYATIR
GYQNDKSYESGCMSICSSIDYISNGSCSGIGCCQISIPEGLHSIDVAVNSYYNHTKVWNF
SPCSYAFVMEEDKFNFSSANLSDLRNVTELPMVIDWAIGNVTCEVAKTSSEYACMKNSMC
YNVQNGAGYGCRCLEGYKGNAYLPHGCQDIDECEEGLNQCTMICINTPGNYSCACPKGYH
GDGRKHGYGCMRDRSQVIMIVLGKHIFLSSPLEAITFLHNLLGHFDLLDSYGIGLQIA
Download sequence
Identical sequences Achn341771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]