SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn342241 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn342241
Domain Number 1 Region: 43-89
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000432
Family alpha-D-mannose-specific plant lectins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn342241
Sequence length 194
Sequence
MCARADSKRRSSIERSERTRRMENRDFSTRPPNSDCETMLMQRLHLLRSGNLALVDAFDQ
IKWQSFNFPTNIMLWGQRLNVKTRLTSFPTNSTSFFSFEIQHDKIALYLNSGKSKYSYWE
FKPSDNRNITFIQVGNKGLNLFGDQYTKIARIPMPRLEPLRFLALGNETGNLGLYYYSPD
NAKFEASFLAINTT
Download sequence
Identical sequences Achn342241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]