SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn366351 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn366351
Domain Number 1 Region: 64-137
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000017
Family alpha-D-mannose-specific plant lectins 0.012
Further Details:      
 
Domain Number 2 Region: 166-236
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000252
Family Protein kinases, catalytic subunit 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn366351
Sequence length 238
Sequence
MLSCSKEEEEEEEEEEVVVVVVVVVNYLERGSSLSFEDDSALVTSPDNSFTCGFYEVGRN
DYGFRIWYTHSENRTVVWMANRDRPVNGKGSKISLLRGGAMVLTDVDGSIAWETNTSRTD
VVKAELLNSGALFNVYKSPSFTGRTFLKLPVTVQASEHTLHNGNDSVCRGLVDERNVAVK
RYGDTFQGDGEFWAEVSTIGKISHMNLVRMWGFCSEGRHRILVYVYVENSSLDKALVL
Download sequence
Identical sequences Achn366351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]