SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn376781 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Achn376781
Domain Number - Region: 178-246
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.000249
Family Frizzled cysteine-rich domain 0.0078
Further Details:      
 
Domain Number - Region: 69-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0977
Family Laminin-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Achn376781
Sequence length 261
Sequence
MGLLRHILLFLFVFLFTTSAESADPSGEFCNTDTNISSNQTSANIDRLLSQLVSGTILNG
YIATSYGKAKDQVYGLAQCRADVTGKDCSTCIEDAAREVLKRCPNQADARIWYDFCFLRY
DIKDFFGEVDTGFGIIFYNVGNVTDPETFNKELATLTDRITSKAVVAGNKGNGRDKTKLT
PFLTLYALVQCTRDLSPLFCSQCLAIATGNFQTICNNRKGCRVLYSSCYVRYELYPFYFP
LDSDTTNASKDYHVSVFYKRP
Download sequence
Identical sequences Achn376781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]