SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn381331 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn381331
Domain Number 1 Region: 289-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000467
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  Achn381331
Domain Number - Region: 243-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000145
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn381331
Sequence length 381
Sequence
MVLQKMNLQLTFIGMVVAAMIAPANGQAKVGCQDSCGNLTNIPYPFGTTKDCYYNEEFLI
TCNNSFTPAKPFLTESNIGVTNISLDGHLHIMQYISQDCYDKFGTPTWNNQPSITLSKFR
ISSTENMFTAIGCDTDATIYGYQGDREYASGCMSICESMDYISNGSCLGIGCCQTSIPKG
VDSYDVTVGSFHNHTKVWNFSPCGYAFVAEKDTFSFSSSDLSGLQNITELPVVLDWTIDN
VTCEVAKKNSTGYACKDNSRCINTDDVSGYRCSCLDGYQGNPYLPSGCQDIDECKDPKLH
LCEKVCVNTIGNYTCSCPKRYYGDGRKDGKGCVADQVFVFKIIITSETSRFALSIDTMTV
YDSIRAPVAVPIDGGRMIRLV
Download sequence
Identical sequences Achn381331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]