SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn014461 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn014461
Domain Number 1 Region: 240-411
Classification Level Classification E-value
Superfamily SIS domain 2.51e-51
Family Phosphoglucose isomerase, PGI 0.0000115
Further Details:      
 
Domain Number 2 Region: 19-192
Classification Level Classification E-value
Superfamily SIS domain 2.52e-39
Family Phosphoglucose isomerase, PGI 0.0000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Achn014461
Sequence length 469
Sequence
MVKSKIEKKFGSPPNRKEKMVAHVDDIKMTHLRELMGDAERCKSMMHWIVMCNAMLDVFY
SEFDGMLLDYSRQLATLETIDKLFKLAEAACLKEKINKMFNGERINSTENRCVLHVALRA
PRDADIKCDGKNVVPDVWQVLDKIKEFSERVRSGSWVGATGKALKDVISIGIGGSFLGPL
FVHTALQTGMYKIVDINCLFPAYSSFCTRVFFGFCSLRQLIPFHVILIVNLFVKENHFVS
MESNGKQVSIDGVVLPYETGEIDFGEPGTNGQHSFYQLIHQGRVVPCDFIGVVKSQQPVY
LKGEVVSNHDELMSNFFAQPDALAFGKTPQQLQNENVPQHLIPHKLLAIYEHRIAVEGFI
WGINSFDQWGVELGKSLASQVRNQLHASRKKGEPVKGFNFSTTTMLKRYLEVLSKEKGFF
WRLRALNLSLRSSMADKTVFDNQISKDFKFIRRLFNCRRLYYDSLRKCL
Download sequence
Identical sequences Achn014461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]