SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn017391 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn017391
Domain Number 1 Region: 156-289
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-41
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 676-751
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000951
Family PB1 domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn017391
Sequence length 800
Sequence
MAASEVSYRGNARGESFSSDYCDPNDGGAGEGNSGGFAHFSGEIPASYVDPETALYTELW
RACAGPLVTVPGGGERVFYFPQGHIEQVEASTNQVSDQEMPVYNLPSKILCRVINVQLKA
EPDTDEVFAQVTLLPLKEDDNDTEKEHVPPSQPRFQVHSFCKTLTASDTSTHGGFSVLRR
HADECLPPLDMSRQPPTQELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVA
GDAFIFLRGENGELRVGVRRAMRQQGNIPSSVISSHSMHLGVLATAWHAYTTGTIFTVYY
KPRTSPAEFIVPYNQYMESVKYNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDADSRRWQ
ESKWRCLKVRWDENSTIPRPERVSPWKIEPASTPPTNNPLPVPRLKRPRTSLVPSSPDSS
VLTREGSSKLTIDPLPASGFTRVLQSRELSTLRGTFAESNELDSSEKAVVWPRSLDDEKI
DVVSASQRCGSDKWLPLLGPESTFTDLLSGFGTRSNSSREFCAPPIDQNSGYISSTKLNF
PQTNWSVISSGLSFNLLESSMKTPAQGSDVPHQTRDVRNGNFGDYSLLTGQKAEHLQGNW
LMPPPALSIEKRTSSVGHANIDFPSQQSGVSESVQSSDQKKFVKAPEYPLPSCEQEKPSQ
IRDHQGKVQGGSTRSCTKVHKQGVALGRSVDLTKFSNYEEFIAELDQLFEFNGELKAGTK
NWLIVFTDDEGDMMLVGDDPWPEFCGMARKVYIYTREEVKQMLPGTLSSKNEENSLVGEG
NDDKDAKNLIPSSDSSPEKC
Download sequence
Identical sequences Achn017391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]