SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn031431 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn031431
Domain Number 1 Region: 508-623
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-28
Family Protein kinases, catalytic subunit 0.0024
Further Details:      
 
Domain Number 2 Region: 78-186
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-27
Family alpha-D-mannose-specific plant lectins 0.0057
Further Details:      
 
Domain Number 3 Region: 679-759,791-822
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.8e-25
Family alpha-D-mannose-specific plant lectins 0.0058
Further Details:      
 
Weak hits

Sequence:  Achn031431
Domain Number - Region: 1094-1185
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000233
Family Protein kinases, catalytic subunit 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn031431
Sequence length 1210
Sequence
MRNTSNPHGSSILWLSTILSLYPILTAAFDTITATQPLTSDQTLVSADGTFELGFFPLGK
LNKWYVGIRYHNIPTRTIVWVANRDNPLTNSPGVLKIGDDGNIVLLDKSQNSTWSLNQIK
STNTVAQLLDTGNFVLRREDDADPQNYLWQSFDYPTDTLLPGMKLGRDKITNLTRYMTSW
KRDDDPSSGDYSFKLDVDGFPEAFLWNREEREYRSGPWNGLRFSGVPEMKPTTILTFSFV
MDSSEITYSFGLKNKSLYSRLLVNPSGVLQRYTWLDTRQEWNIFWYAPKDQCDSYKECGV
FGVCDTNSSPVCKCMKGFAPKNPQEWYLRDGSDGCVRTTKLNCVDDGFLALKNMKLPESA
TVALDGGMSIEECGEACRKNCSCTAYGSMDIRGRGSGCVMWGGDLVDLRQYAAAEGGQDL
YVKVAAADLDGSMGIKKSSDKSEQTIKVVGITVGVGVLLLGLIILFVWNKKRMDRVLKEK
IEHRGAHERSQDFLLNEGVIMSKREFSSETAIDELELPLFDFSTMMMATGNFSDSNKLGQ
GGFGIVYKGMLVEGQEIAVKRLSRNSGQGIEEFKNEVRLIARLQHRNLVRLLGCCVEIDE
KLLIYEYMENRSLDSILFTIPLSVFFTNALDTLSPSQTLTDNGQTLVSVGEHFELGFFSP
WNSGNRYVGIWFKQVPLQTPIWVANRNNPITDSSGVLEITPTGNILITKSNQTNPIWYSN
SSSPSATTSTVQLLDTGNLVVKSGNSGNYLWQSFDDPCDTLVPGMKLGWNLETKKEWYMT
SWKSLGDPAPGDYTYRLDPRGLPQVVLRQGSTVVYRSGPWDGVRFGGGPPLKENTVFSPI
FVFNESYVYYSFQNIDDGIISRFVVNQSGQLDHMTWNPRLGEWNSIVALRGDTCDGYNLC
GSYGLCNTNKQPICHCPDGFEPRQPLDWKRLTWTGGCVRTTEPNCSTPQGFMKVSGLKLP
DTSNFLVNSGMSKVDCEAACLRNCSCMGYAKTDISGCVVWFGELLDIRMYNEGGQDLYIR
MAASELGSKKKKPTAVIASVSVISGILVLGLISWFVIRKRIVQRRGAFNGFLSPSSKNSK
FYLSEKLSTRRSKSCLNSWFGFFGHFLCAWKLWNEGKPMKLVDASMETPVPTLEVLRCIQ
MALLCVQQRPEDRPAMPAVLLMLDSENPTLLQPKQPGFYSERFMGDTDSSSTGRNPFTSN
EVTITTLHGR
Download sequence
Identical sequences Achn031431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]