SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn144911 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn144911
Domain Number 1 Region: 457-631
Classification Level Classification E-value
Superfamily Chorismate mutase II 1.19e-62
Family Allosteric chorismate mutase 0.0000762
Further Details:      
 
Domain Number 2 Region: 621-772
Classification Level Classification E-value
Superfamily At5g01610-like 3.27e-41
Family At5g01610-like 0.00000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Achn144911
Sequence length 774
Sequence
MEHRFASTYPSETRPQAPRITNRKKRPQTQAICLIPLLLFFSLDIILTLIFGSFERNPTG
TQDFDILEENSEQKWESPEPTWSITCDRSHFEYDLCYINRPCVLDPTTAILSSADPTNST
PPLVERIRPYPRKWQHNAMENVKEVTLTTTPLYSPCGVTHDTPALVFSAGGFTSNIFHDF
NEGFIPLFVTVDSFFTNQDVILAIVNCRDWWLNKYGELIARFTRHPIINLDKETVAHCFP
SAIVGLMSHGPMTVDPTLQRGPNPKTVLDFHAILKTTYGRGFTLPPRHRPQLVLMSRRHH
RVIVNQDKVVQVAEDVGFNVVVFEPTQKTPMQEVFRVLYSSHVMIGVHGAGLTNELFLRS
GAVFVQIVPIRNSWLGDICYGKLALRLGLEYIVYDVAIQESSLADQFPKDKLDPNDQGVP
VFLAENLQLRLSLSPQFCTLELLQGSSMLYSTKVTLQYTYDHNAFSMDGFRGSLVEFMLR
ETEKLHAQVGRYESPDEHPFFPTDLPEPMLPPLQYPPVLHRCAASININSKIWNMYFSDL
LPRLVKPGDDGNSGSTAVCDTICLQALSKRIHYAVEEAVKTRVEVKAKTYGAEVRINQEA
DAADPAYKIKPSLVANLYGHWIMPLTKEIQVFSNTVEEKAKWIFNKLKGKELKSLPDLLR
EHNLPPGLFPQNITCYEFDQSNAKLTVHLPSACEVSFKDSSVIRYATRVKGVLMKGKLTG
IEGMKTKVLVWVKVTSVTVEGYKSDKVWFTAGVKKSRPLDAYGSPHHAVRVQEF
Download sequence
Identical sequences Achn144911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]