SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn190531 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn190531
Domain Number 1 Region: 20-63
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000222
Family alpha-D-mannose-specific plant lectins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn190531
Sequence length 183
Sequence
MVITDIRLIPIIVNYGLLATSGNNHTTKLLDSGNLVLVEEDESIVWQSFAYPTDTFLPGI
KWEVLDLDTDRIRNQFLVSWLSPLVSNSGHFALGVARINRTFYNVWHTNGMFRQFRFWDS
HNFRFFFNSSSDRYNFTFVLTRKEVYLSFVMKRNSNYSWFVLTSTGEINKFTIVGLGDHS
CKP
Download sequence
Identical sequences Achn190531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]