SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn199161 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn199161
Domain Number 1 Region: 60-107
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000089
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn199161
Sequence length 201
Sequence
MTHSILYCVHKGAETSTCTNTKFSNQTGPSFQFSNQTKIPFTIFEKENSSGCNNHGTNPR
VLWPANKVNPAKMNAILTFTSNGDLILRYANGTLAWSTNTSGKSVVGMKISSAFIEANPP
RVYMKLFHEDYLFYPLKIGSLDYFENEYNDPYAVAYESETKLFQYMRLEWDGHMRIYEWV
EGIEAIVDDVPASRLRTVLIP
Download sequence
Identical sequences Achn199161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]