SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Achn252961 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn252961
Domain Number 1 Region: 164-263
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.97e-27
Family B3 DNA binding domain 0.00018
Further Details:      
 
Domain Number 2 Region: 45-102
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000000981
Family GCC-box binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Achn252961
Sequence length 351
Sequence
MEEEPSSMIEDVKTRVITEDSVSSSPCQPSNAGMHPIKDNKAMSSKFKGVVPQPNGHWGA
QIYANHQRIWLGTFKSEIEAAMVYDSASLKLRTGDNYRNFPWTNVTVHEPKFQSLHSTEA
ILNMIKDGSYPSKFAVFLGSQKGEQDLGVNLIKGHGHGGFSCKLLFQKELTPSDVGKLNR
LVIPKKYAVKYFPEVPESTEENIDDGKVDEVYLFFYDRIMRLWKFRYCYWKSSQSFVFTR
GWNRFVKEKGLKENDIIAFYVCEGRERAKEGQPFCAIDVVYTGGSRNSRVDEGRSQNVDT
QVDLHLRLGQNLSCWLVKKDDEEFENSKFFTGLKPTPNGKKSVRLFGVELN
Download sequence
Identical sequences Achn252961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]