SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn281121 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn281121
Domain Number 1 Region: 62-155,187-217
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.24e-23
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 
Weak hits

Sequence:  Achn281121
Domain Number - Region: 351-395
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000182
Family Hairpin loop containing domain 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Achn281121
Sequence length 458
Sequence
MATRNNLTLIIFHFFLCLSLDTHLSHGADTISANQSLSGDQTIVSSGGNFELGFYETGNS
YYYICMWYKKVSTRTVVWVANRDSPISDKYSTVLTIRDSNLVHLNESQIPIWSTNHKPTS
PISEIAVLGDDGNLVLKEGFNSTEPIWQSFDYPVHTWLPGSKIAYNKRTNTHQRLTSWEN
IEDPSTGLFSLNLDANNSQFLIMWNGSEQYWTSGPWNGQIFSLVPEMRDNNMYNFTYVDN
ENESYLMYYLYNSLIISRFIMDVSGQVQQLTWLENTEEWNLFWAQPRQQCEVYAFCGAYG
TCNQIIPPICNCLPGFSPKFMADWNLSDYSGGCARKKLLQCENPMASNKDSDRFWEYPNM
RLPEHPQSVGVNSNTECKSSCLSNCSCTAYAYDSDGCSVWYGELVNLQQLEGNDGNGSTL
YLRLAASEVSSAKSNKGIVISTVVGSVVGLLGLVVMVI
Download sequence
Identical sequences Achn281121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]