SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn281131 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn281131
Domain Number 1 Region: 477-732
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.68e-45
Family Protein kinases, catalytic subunit 0.0017
Further Details:      
 
Domain Number 2 Region: 62-155,187-217
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.49e-26
Family alpha-D-mannose-specific plant lectins 0.0023
Further Details:      
 
Weak hits

Sequence:  Achn281131
Domain Number - Region: 350-395
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000667
Family Hairpin loop containing domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn281131
Sequence length 742
Sequence
MATRNNLTLIIFLFFLCFSLNTHLSHGADTISANQSLSGDQTIVSSGGNFELGFYEPGNS
YYYICMWYKKVSTRTIVWVANRDSPISDKYSSVLIIRDGNLVLLNESQIPIWSTNHKPTS
PISVIAVLGDDGNLVLKEEFNSTEPIWQSFDYPVHTFLPGSKIAYNKRTNTHQRLTSWKN
IEDPSTGLFSLNLDANNSQYLIMRNGSEQYWNSGPWNGQIFSLVPEMRTNYIYNFNYVDN
ENESYFIYSLYNPSIISRLIMDVSGQVKQLTWLESTKEWNLFWTQPRYQCDVYAFCGEFS
TCNQITPPFCNCLHGFSPKSMADWNLSDYSGGCARKKLLQCENPMASNKASDRFWEYPNM
RLPEHPQSVAVNSDTECKSSCLSSCSCTAYAYDSDGCSVWFGELVNLQQLEENDDSGRTF
YLRLAVSELSSAKSNKAVVISTVVGSVVVLLGLVVIVIWRRQRRSAGPMKLVEGSLVAFG
YRDLQTATKNFSEKLGGGGFGSVFKGTLPDSTVVAVKKLESINQGEKQFRTEVSTIGTIQ
HFNLVRLRGFCSEGNKKLLVYDYMQSGSLDSHLFQEKDGNRVLTTMRGTRGYLAPEWISG
VAITAKADVYSYGMMLFELISGRRNFEQSEDGKVKFLPTWAASVVVEGNDLISLLDHRLG
GNADAEELKRIARVACWCIQDDENNRPTMGLVVQILEGFLEVNPPPLPQSLQLLIDNHEH
MVFFTELSSSQSSQTTEQFSFN
Download sequence
Identical sequences Achn281131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]