SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn345161 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn345161
Domain Number 1 Region: 74-179
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.32e-24
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Weak hits

Sequence:  Achn345161
Domain Number - Region: 352-402
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0745
Family Pan module (APPLE domain) 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Achn345161
Sequence length 493
Sequence
MGTFLSLTFLFLFLAISSQTCLAATDTLTRSQPISVGQSLTSSGQIFELGFFSLNNSSKQ
YVGIWYKNVSVQQVLWVANRDNPADSTSSLTIGIDGNLRILDGMGKPIWETNVSTQTNNS
IAVLSDKGDFVLKDYVSGWTLWESFSYPGHAFLPGMMIGMNTKTGEKHFCTSWKTEDDPS
PGEFIGGTTLDTPPQAMIWRGSKPYWRSGPWDGSRFIGIADRFQGYANGFNLVVDNQMGT
VYFTFNKYNVSDVTVLVLIPSGSWQIMHWGIKSNTWYVTWEQPKHPCDTYGFCGAFGVCN
RNGSRNCECLKGFVPKSLEEWSKSNWTSGCMRKTKLLCEKNRSILASGRGKNDGFSKLKN
MKLPDKFKYIADENSHGCEEWCLHNCSCAAYAYVSGIGCMVWVGELMDTQQFLSPAGEDL
FLRLASSELGKDNKKEKLIIGLTMVSGVILLGAVIYGLYRWRANRKAAICLPSMQWEGYS
PRSLMSLASGSCY
Download sequence
Identical sequences Achn345161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]