SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Achn357151 from Actinidia chinensis Hongyang

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Achn357151
Domain Number 1 Region: 73-182
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-25
Family alpha-D-mannose-specific plant lectins 0.0071
Further Details:      
 
Weak hits

Sequence:  Achn357151
Domain Number - Region: 341-404
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0002
Family Anti-platelet protein 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Achn357151
Sequence length 434
Sequence
MDGSAILVLLWSTMFFSISIPSNSIPDTITPNQTITANETIVSSQGNFELGFFTKSKNWY
LGIWYKKISPGMVVWVANRVVALTDPSGVLRITNPGILGLFNSSGTLIWSSNSSTSVLNP
IAQLLDSGNLVVRDQNEPNPEIFLWQSFDYPSDNFLPGMRFGKNLKTGLDRYFTSWKSSE
DPSPGNFTYRLDPSGDPQLIMRNGDVVKFRSGPWNGLRFSGFPQMGPNTVYAFGFVFNQE
EVYYYFNLVNDSVVTRLVLNPNGQIQRFAWVDRTRGWVLYSSAQTDNCDNYALCGVYGTC
NINRSPPCGCLKGFKAKFQQDWDMADWSNGCIRTTPLDCRKDGFVKYSGIKLPDTRYSWI
NKSMDLRECRKTCLENCNCTAYTNYDIREGGSGCLLWFGDLIDIREYDENGQDLFMRMAA
SEIGMELIASIKLN
Download sequence
Identical sequences Achn357151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]